Recombinant Human RanBP1 protein (ab114663)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP43487
    • SpeciesHuman
    • SequenceMAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFK MRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICA NHYITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAIRFLNAENAQK FKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEK Q
    • Molecular weight49 kDa
    • Amino acids1 to 210

Specifications

Our Abpromise guarantee covers the use of ab114663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HTF9A
    • RAN binding protein 1
    • Ran specific GTPase activating protein
    • Ran-binding protein 1
    • Ran-specific GTPase-activating protein
    • RANBP1
    • RANG_HUMAN
    see all
  • FunctionInhibits GTP exchange on Ran. Forms a Ran-GTP-RANBP1 trimeric complex. Increase GTP hydrolysis induced by the Ran GTPase activating protein RANGAP1. May act in an intracellular signaling pathway which may control the progression through the cell cycle by regulating the transport of protein and nucleic acids across the nuclear membrane.
  • Sequence similaritiesBelongs to the RANBP1 family.
    Contains 1 RanBD1 domain.
  • Information by UniProt

Recombinant Human RanBP1 protein images

  • SDS-PAGE analysis of ab114663 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human RanBP1 protein (ab114663)

ab114663 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"