Recombinant Human RANBP10 protein (ab163605)

Overview

  • Product name
    Recombinant Human RANBP10 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAATADPGAGNPQPGDSSGGGAGGGLPSPGEQELSRRLQRLYPAVNQQE TPLPRSWSPKDKYNYIGLSQGNLRVHYKGHGKNHKDAASVRATHPIPAAC GIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSF CSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANL YPTVGLQTPGEIVDANFGQQPFLFDIEDYMREWRAKVQGTVHCFPISARL GEWQAVLQNMVSSYLVHHGYCATATAFARMTETPIQEEQASIKNRQKIQK LVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRS LSSRSPKSQDSYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSKQ NHSKYPAPSSSSSSSSSSSSSSPSSVNYSESNSTDSTKSQHHSSTSNQET SDSEMEMEAEHYPNGVLGSMSTRIVNGAYKHEDLQTDESSMDDRHPRRQL CGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQDAFSLLAYSD PWSCPVGQQLDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLR LMARAGLGSCSFARVDDYLH
    • Amino acids
      1 to 620
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ31165
    • KIAA1464
    • RAN binding protein 10
    • Ran-binding protein 10
    • RanBP10
    • RBP10_HUMAN
    see all
  • Function
    May act as an adapter protein to couple membrane receptors to intracellular signaling pathways. In contrast to RANBP9, does not interact with Sos and does not activate the Ras pathway.
  • Tissue specificity
    Broadly expressed, with highest levels in skeletal muscle.
  • Sequence similarities
    Belongs to the RANBP9/10 family.
    Contains 1 B30.2/SPRY domain.
    Contains 1 CTLH domain.
    Contains 1 LisH domain.
  • Domain
    The SPRY domain mediates the interaction with MET.
  • Information by UniProt

Images

  • ab163605 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163605 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up