Overview

  • Product nameRecombinant Human RAP1B protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61224
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMREYKLVVLGSGGVGKSALTVQFVQGIFVE KYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFAL VYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQ GQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS C
    • Molecular weight23 kDa including tags
    • Amino acids1 to 181
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103049 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • GTP-binding protein smg p21B
    • K-REV
    • OK/SW-cl.11
    • RAL1B
    • rap1b
    • RAP1B member of RAS oncogene family
    • RAP1B_HUMAN
    • Ras family small GTP binding protein RAP1B
    • RAS related protein RAP1B
    • Ras-related protein Rap-1b
    • Small GTP binding protein
    see all
  • FunctionGTP-binding protein that possesses intrinsic GTPase activity. Contributes to the polarizing activity of KRIT1 and CDH5 in the establishment and maintenance of correct endothelial cell polarity and vascular lumen. Required for the localization of phosphorylated PRKCZ, PARD3 and TIAM1 to the cell junction.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Ras family.
  • Cellular localizationCell membrane. Cytoplasm > cytosol. Cell junction. May shuttle between plasma membrane and cytosol. Presence of KRIT1 and CDH5 is required for its localization to the cell junction.
  • Information by UniProt

Recombinant Human RAP1B protein images

  • 15% SDS-PAGE analysis of 3µg ab103049

References for Recombinant Human RAP1B protein (ab103049)

ab103049 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103049.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"