Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP10114
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMREYKVVVLGSGGVGKSALTVQFVTGTFIE KYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFIL VYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSE GRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSAC
    • Molecular weight22 kDa including tags
    • Amino acids1 to 180
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104552 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104552 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

Recombinant Human Rap2A protein images

  • 15% SDS-PAGE analysis of 3µg ab104552.

References for Recombinant Human Rap2A protein (ab104552)

ab104552 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104552.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"