Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSP SVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQI IRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNK ASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    purified by affinity chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • MGC20484
    • RAP 2B
    • RAP2A
    • Rap2b
    • RAP2B member of RAS oncogene family
    • RAP2B_HUMAN
    • Ras family small GTP binding protein RAP2B
    • Ras related protein RAP 2B
    • Ras related protein RAP2B
    • Ras-related protein Rap-2b
    • Small GTP binding protein
    see all
  • FunctionSmall GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.
  • Tissue specificityExpressed in red blood cells (at protein level).
  • Sequence similaritiesBelongs to the small GTPase superfamily. Ras family.
  • DomainThe effector domain mediates the interaction with RUNDC3A.
  • Post-translational
    modifications
    Palmitoylated. Palmitoylation is required for association with recycling endosome membranes and activation of TNIK.
  • Cellular localizationRecycling endosome membrane. Associated with red blood cells-released vesicles.
  • Information by UniProt

References for Recombinant Human RAP2B protein (ab88159)

ab88159 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"