Recombinant Human Raptor protein (ab112419)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWR MKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALE TIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHY NGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAG LIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATE LLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNF LLAERIMRSYNCTPVSSPRLPPTYMHAMW
    • Molecular weight
      68 kDa including tags
    • Amino acids
      1 to 379

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • KIAA1303
    • KOG1
    • Mip1
    • P150 target of rapamycin (TOR) scaffold protein
    • p150 target of rapamycin (TOR) scaffold protein containing WD repeats
    • P150 target of rapamycin (TOR)-scaffold protein
    • Raptor
    • Regulatory associated protein of mTOR
    • Regulatory associated protein of MTOR complex 1
    • Regulatory-associated protein of mTOR
    • RPTOR
    • RPTOR_HUMAN
    see all
  • Function
    Involved in the control of the mammalian target of rapamycin complex 1 (mTORC1) activity which regulates cell growth and survival, and autophagy in response to nutrient and hormonal signals; functions as a scaffold for recruiting mTORC1 substrates. mTORC1 is activated in response to growth factors or amino-acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino-acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation.
  • Tissue specificity
    Highly expressed in skeletal muscle, and in a lesser extent in brain, lung, small intestine, kidney and placenta.
  • Sequence similarities
    Belongs to the WD repeat RAPTOR family.
    Contains 7 WD repeats.
  • Cellular localization
    Cytoplasm. Lysosome. Targeting to lysosomes depends on amino acid availability.
  • Information by UniProt

Images

  • ab112419 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

The protein is tagged at the N terminus.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up