Recombinant Human RARRES1 protein (ab114592)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQ DAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCK VHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIE KKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSS YVMWEMTTQVSHYYLAQLTSVRQWVRKT
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 228

Specifications

Our Abpromise guarantee covers the use of ab114592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5430417P09Rik
    • AI662122
    • RAR-responsive protein TIG1
    • RARRES1
    • Retinoic acid receptor responder (tazarotene induced) 1
    • Retinoic acid receptor responder protein 1
    • Tazarotene induced gene 1 protein
    • Tazarotene-induced gene 1 protein
    • TIG1
    • TIG1_HUMAN
    see all
  • Sequence similarities
    Belongs to the protease inhibitor I47 (latexin) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human RARRES1 protein images

  • 12.5% SDS-PAGE showing ab114592 at approximately 50.71kDa stained with Coomassie Blue.

References for Recombinant Human RARRES1 protein (ab114592)

ab114592 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up