Recombinant Human RARRES1 protein (ab114592)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQ DAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCK VHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIE KKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSS YVMWEMTTQVSHYYLAQLTSVRQWVRKT
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 228

Specifications

Our Abpromise guarantee covers the use of ab114592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5430417P09Rik
    • AI662122
    • RAR-responsive protein TIG1
    • RARRES1
    • Retinoic acid receptor responder (tazarotene induced) 1
    • Retinoic acid receptor responder protein 1
    • Tazarotene induced gene 1 protein
    • Tazarotene-induced gene 1 protein
    • TIG1
    • TIG1_HUMAN
    see all
  • Sequence similarities
    Belongs to the protease inhibitor I47 (latexin) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114592 at approximately 50.71kDa stained with Coomassie Blue.

References

ab114592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up