Recombinant Human RARRES1 protein (ab114593)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49788
    • SpeciesHuman
    • SequenceEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHL VWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
    • Molecular weight36 kDa including tags
    • Amino acids205 to 294

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5430417P09Rik
    • AI662122
    • RAR-responsive protein TIG1
    • RARRES1
    • Retinoic acid receptor responder (tazarotene induced) 1
    • Retinoic acid receptor responder protein 1
    • Tazarotene induced gene 1 protein
    • Tazarotene-induced gene 1 protein
    • TIG1
    • TIG1_HUMAN
    see all
  • Sequence similaritiesBelongs to the protease inhibitor I47 (latexin) family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human RARRES1 protein images

  • 12.5% SDS-PAGE showing ab114593 at approximately 35.53kDa stained with Coomassie Blue.

References for Recombinant Human RARRES1 protein (ab114593)

ab114593 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"