Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20936-2
    • SpeciesHuman
    • SequenceMKGWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVV NHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEP VEDRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDE QGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVR PSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHYR KEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVK KGYLLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSV YVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCN LRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAK THAREGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQL SRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEYSEFK ELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDRE ISMEDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQS CELSPSKLEKNEDVNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCL QKSVQHKWPTNTTMRTRVVSGFVFLRLICPAILNPRMFNIISDSPSPIAA RTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIMFLDELGNV PELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLL AITELLQQKQNQYTKTNDVR
    • Molecular weight122 kDa including tags
    • Amino acids1 to 870

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CM AVM
    • CMAVM
    • DKFZp434N071
    • GAP
    • GTPase activating protein
    • GTPase-activating protein
    • OTTHUMP00000222390
    • OTTHUMP00000222391
    • OTTHUMP00000222392
    • OTTHUMP00000222393
    • p120GAP
    • p120RASGAP
    • PKWS
    • Ras GTPase-activating protein 1
    • Ras p21 protein activator
    • RAS p21 protein activator (GTPase activating protein) 1
    • RASA
    • RASA1
    • RASA1_HUMAN
    • RasGAP
    • Triphosphatase activating protein
    see all
  • FunctionInhibitory regulator of the Ras-cyclic AMP pathway. Stimulates the GTPase of normal but not oncogenic Ras p21.
  • Tissue specificityIn placental villi, detected only in the trophoblast layer (cytotrophoblast and syncytiotrophoblast). Not detected in stromal, endothelial or Hofbauer cells (at protein level).
  • Involvement in diseaseNote=Mutations in the SH2 domain of RASA seem to be oncogenic and cause basal cell carcinomas.
    Defects in RASA1 are the cause of capillary malformation-arteriovenous malformation (CMAVM) [MIM:608354]. CMAVM is a disorder characterized by atypical capillary malformations that are multiple, small, round to oval in shape and pinkish red in color. These capillary malformations are associated with either arteriovenous malformation, arteriovenous fistula, or Parkes Weber syndrome.
    Defects in RASA1 are a cause of Parkes Weber syndrome (PKWS) [MIM:608355]. PKWS is a disorder characterized by a cutaneous flush with underlying multiple micro-arteriovenous fistulas, in association with soft tissue and skeletal hypertrophy of the affected limb.
  • Sequence similaritiesContains 1 C2 domain.
    Contains 1 PH domain.
    Contains 1 Ras-GAP domain.
    Contains 2 SH2 domains.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human RASA1 protein images

  • 12.5% SDS-PAGE showing ab116964 at approximately 121.77kDa stained with Coomassie Blue.

References for Recombinant Human RASA1 protein (ab116964)

ab116964 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"