Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIGSRFLNGRFEDQYTP TIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSL DNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQ VPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPAL HRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAK VLREGQARERDKCTIQ
    • Amino acids
      1 to 266
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GTP binding protein Rhes
    • GTP-binding protein Rhes
    • MGC:4834
    • OTTHUMP00000197925
    • Ras homolog enriched in striatum
    • RASD 2
    • RASD family member 2
    • RASD2
    • Rhes
    • RHES_HUMAN
    • TEM 2
    • TEM2
    • Tumor endothelial marker 2
    see all
  • Function
    GTPase signaling protein that binds to and hydrolyzes GTP. Regulates signaling pathways involving G-proteins-coupled receptor and heterotrimeric proteins such as GNB1, GNB2 and GNB3. May be involved in selected striatal competencies, mainly locomotor activity and motor coordination.
  • Tissue specificity
    Pancreatic endocrine cells (islets of Langerhans).
  • Sequence similarities
    Belongs to the small GTPase superfamily. RasD family.
  • Post-translational
    modifications
    Farnesylated. Farnesylation is required for membrane targeting.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab153238 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up