Recombinant Human RASGEF1C protein (ab166046)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPQTLSASDMVTPGSLSPPPTEPTDGEQAGQPLLDGAPSSASLETLIQHL VPTADYYPEKAYIFTFLLSSRLFIEPRELLARVCHLCIEQQQLDKPVLDK ARVRKFGPKLLQLLAEWTETFPRDFQEESTIGHLKDVVGRIAPCDEAYRK RMHQLLQALHQKLAALRQGPEGLVGADKPISYRTKPPASIHRELLGVCSD PYTLAQQLTHVELERLRHIGPEEFVQAFVNKDPLASTKPCFSDKTSNLEA YVKWFNRLCYLVATEICMPAKKKQRAQVIEFFIDVARECFNIGNFNSLMA IISGMNMSPVSRLKKTWAKVRTAKFFILEHQMDPTGNFCNYRTALRGAAH RSLTAHSSREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFLELAK QVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESESPENQT EKERWKALRSSILGKT
    • Amino acids
      1 to 466
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ35841
    • OTTHUMP00000161522
    • Ras GEF domain containing family member 1C
    • RASGEF 1C
    • RasGEF domain containing family member 1C
    • RasGEF domain family member 1C
    see all
  • Relevance
    RasGEF1c is a guanine nucleotide exchange factor (GEF) for Ras-like small GTPases. Small GTP-binding proteins of the Ras superfamily function as molecular switches in fundamental events such as signal transduction, cytoskeleton dynamics and intracellular trafficking. There are two isoforms.

Images

  • ab166046 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up