Recombinant Human RASGRP 4 protein (ab153581)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGL LSEGGCSEDELLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAA RLLTSYQKATGDTQELRRLQICHLVRYWLMRHPEVMHQDPQLEEVIGRFW ATVAREGNSAQRRLGDSSDLLSPGGPGPPLPMSSPGLGKKRKVSLLFDHL ETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPALEGSVGLSNSV SRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLHQLQNFNTLMAVTGGLCHS AISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPV LGVHLKDLVSLHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCS ANEDLLHLLTLSLDLFYTEDEIYELSYAREPRCPKSLPPSPFNAPLVVEW APGVTPKPDRVTLGRHVEQLVESVFKNYDPEGRGTISQEDFERLSGNFPF ACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFLHTFHEVTFRK PTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDA GPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPS WETDTVPCPVMDPPSTASSKLDS
    • Amino acids
      1 to 673
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GRP4_HUMAN
    • Guanyl nucleotide releasing protein 4
    • RAS guanyl releasing protein 4
    • RAS guanyl-releasing protein 4
    • RASGRP4
    see all
  • Function
    Functions as a cation- and diacylglycerol (DAG)-regulated nucleotide exchange factor activating Ras through the exchange of bound GDP for GTP. May function in mast cells differentiation.
  • Tissue specificity
    Expressed by mast cells and their progenitors (at protein level). Specifically expressed in mononuclear leukocytes. Highly expressed in myeloid cells compared to lymphoid cells. Also detected in heart, skeletal muscle, spleen, liver, placenta and lung. Not detected in brain. Isoform 1 is the major isoform in normal individuals. Isoform 2 is more significantly expressed in a patient with asthma. Isoform 3 is more significantly expressed in a patient with asthma and a mastocytosis patient.
  • Sequence similarities
    Belongs to the RASGRP family.
    Contains 1 EF-hand domain.
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Ras-GEF domain.
  • Developmental stage
    Expressed early during development. Detected in all fetal tissues tested.
  • Domain
    The phorbol-ester/DAG-type zinc finger mediates the binding and the functional activation by DAG.
  • Cellular localization
    Cytoplasm. Cell membrane. Recruited to membranes upon activation by DAG.
  • Information by UniProt

Images

  • ab153581 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up