Recombinant Human RASSF4 protein (ab164467)

Overview

  • Product name
    Recombinant Human RASSF4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGT LIIEGLLNIAWGLRRPIRLQMQDDREQVHLPSTSWMPRRPSCPLKEPSPQ NGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTKSDASCMSQRR PKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRVNSTMTTL QVLTLLLNKFRVEDGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCE KIARIFLMEADLGVEVPHEVAQYIKFEMPVLDSFVEKLKEEEEREIIKLT MKFQALRLTMLQRLEQLVEAK
    • Amino acids
      1 to 321
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3830411C14Rik
    • AD037
    • AI586137
    • MGC105606
    • MGC44914
    • OTTHUMP00000019493
    • Ras association (RalGDS/AF 6) domain family 4
    • Ras association (RalGDS/AF 6) domain family member 4
    • Ras association domain containing protein 4
    • Ras association domain family 4
    • Ras association domain-containing protein 4
    • RASF4_HUMAN
    • RASSF 4
    • Rassf4
    • RP11-285G1.4
    • Tumor suppressor RASSF4
    see all
  • Function
    Potential tumor suppressor. May act as a KRAS effector protein. May promote apoptosis and cell cycle arrest.
  • Tissue specificity
    Widely expressed. Frequently down-regulated in tumor cell lines.
  • Sequence similarities
    Contains 1 Ras-associating domain.
    Contains 1 SARAH domain.
  • Information by UniProt

Images

  • ab164467 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up