Recombinant Human RASSF8 protein (ab161359)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPT SDSVARIPERTLYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAK
    • Amino acids
      40 to 137
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C12orf2
    • Carcinoma associated HOJ 1
    • Carcinoma associated protein HOJ 1
    • Carcinoma-associated protein HOJ-1
    • HoJ 1
    • HoJ1
    • Ras association (RalGDS/AF 6) domain family (N terminal) member 8
    • Ras association (RalGDS/AF 6) domain family 8
    • Ras association domain containing protein 8
    • Ras association domain family 8
    • Ras association domain-containing protein 8
    • RASF8_HUMAN
    • RASSF 8
    • Rassf8
    see all
  • Tissue specificity
    Widely expressed as a 6.2 kb transcript. A 2.2 kb alternatively spliced transcript is expressed exclusively in testis.
  • Involvement in disease
    Note=A chromosomal aberration involving RASSF8 is found in a complex type of synpolydactyly referred to as 3/3-prime/4 synpolydactyly associated with metacarpal and metatarsal synostoses. Reciprocal translocation t(12;22)(p11.2;q13.3) with C12orf2.
  • Sequence similarities
    Contains 1 Ras-associating domain.
  • Information by UniProt

Images

  • ab161359 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up