Overview

  • Product nameRecombinant Human RBBP9 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO75884
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASPSKAVIVPGNGGGDVTTHGWYGWVKKE LEKIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTIIIGHSSGAIA AMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYI VQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKS LLKVPA
    • Molecular weight23 kDa including tags
    • Amino acids1 to 186
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab115718 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • B5T overexpressed gene protein
    • B5T-overexpressed gene protein
    • BOG
    • Bog protein
    • MGC9236
    • OTTHUMP00000030360
    • Protein BOG
    • Putative hydrolase RBBP9
    • RBBP 10
    • RBBP 9
    • RBBP-10
    • RBBP-9
    • RBBP10
    • RBBP9
    • RBBP9_HUMAN
    • Retinoblastoma binding protein 10
    • Retinoblastoma binding protein 9
    • Retinoblastoma-binding protein 10
    • Retinoblastoma-binding protein 9
    • Retinoma binding protein 9
    see all
  • FunctionMay play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.
  • Tissue specificityWidely expressed. Expressed at higher levels in tumor tissues than in normal tissues.
  • Sequence similaritiesBelongs to the RBBP9 family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human RBBP9 protein images

  • 15% SDS-PAGE showing ab115718 (3µg).

References for Recombinant Human RBBP9 protein (ab115718)

ab115718 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"