Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGF PPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQ
    • Amino acids
      3 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf18
    • Chromosome 20 open reading frame 18
    • HBV associated factor 4
    • HBV-associated factor 4
    • Heme-oxidized IRP2 ubiquitin ligase 1
    • Hepatitis B virus X associated protein 4
    • Hepatitis B virus X-associated protein 4
    • HOIL 1L
    • HOIL-1
    • HOIL-1L
    • HOIL1
    • HOIL1L
    • RanBP type and C3HC4 type zinc finger containing 1
    • RanBP-type and C3HC4-type zinc finger-containing protein 1
    • RBCC protein interacting with PKC1
    • Rbck1
    • RBCK2
    • RING finger protein 54
    • RNF54
    • UB7I3_HUMAN
    • UBCE7IP3
    • Ubiquitin conjugating enzyme 7 interacting protein 3
    • Ubiquitin-conjugating enzyme 7-interacting protein 3
    • XAP3
    • XAP4
    • ZRANB4
    see all
  • Function
    Acts as an E3 ubiquitin-protein ligase, or as part of an E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates. Functions as an E3 ligase for oxidized IREB2 and both heme and oxygen are necessary for IREB2 ubiquitination. Promotes ubiquitination of TAB2 and IRF3 and their degradation by the proteoasome. Component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates. LUBAC conjugates linear polyubiquitin to IKBKG at 'Lys-285' and 'Lys-309' and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. LUBAC is proposed to be recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Binds polyubiquitin of different linkage types.
  • Sequence similarities
    Contains 1 B box-type zinc finger.
    Contains 1 RanBP2-type zinc finger.
    Contains 1 RING-type zinc finger.
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications
    Auto-ubiquitinated. Auto-ubiquitination leads to degradation by the proteasome.
    Phosphorylated. In vitro, phosphorylation inhibits auto-ubiquitination activity.
  • Information by UniProt

Images

  • ab161073 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up