Overview

  • Product name
    Recombinant Human RBM19 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRLIVKNLPNGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFK SEEEAQKAQKHFNKSFIDTSRITVEFCKSFGDPAKPRAWSKHAQKPSQPK QPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVHQRRAQAATWA NDGLDAEPSKGKSKPASDYLNFDSDSGQESEEEGAGEDLEEEASLEPKAA VQKELSDMDYLKSKMVKAGSSSSSEEEESEDEAVHCDEGSEAEEEDSSAT PVLQERDSKGAGQEQGMPAGKKRPPEARAETEKPANQKEPTTCHTVKLRG APFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQAL KCNREYMGGRYIEVFREKNVPTTKGAPKNTTKSWQGRILGENEEEEDLAE SGRLFVRNLPYTSTEEDLEKLFSKYGPLSELHYPIDSLTKKPKGFAFITF MFPEHAVKAYSEVDGQVFQGRMLHVLPSTIKKEASEDASALGSSSYKKKK EAQDKANSASSHNWNTLFMGPNAVADAIAQKYNATKSQVFDHETKGSVAV RVALGETQLVQEVRRFLIDNGVSLDSFSQAAAERSKTVILVKNLPAGTLA AELQETFGHFGSLGRVLLPEGGITAIVEFLEPLEARKAFRHLAYSKFHHV PLYLEWAPVGVFSSTAPQKKKLQDTPSEPMEKDPAEPETVPDGETPEDEN PTEEGADNSSAKMEEEEEEEEEEEESLPGCTLFIKNLNFDTTEEKLKEVF SKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVVD GHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIPFQAHSREIRE LFSTFGELKTVRLPKKMTGTGTHRGFGFVDFLTKQDAKRAFNALCHSTHL YGRRLVLEWADSEVTLQALRQKTAAHFHEPPKKKRSVVLDEILEQLEGSD SDSEEQTLQL
    • Amino acids
      1 to 960
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1200009A02Rik
    • AV302714
    • NPO
    • Probable RNA-binding protein 19
    • RBM19
    • RBM19_HUMAN
    • RNA-binding motif protein 19
    see all
  • Function
    Plays a role in embryo pre-implantation development.
  • Tissue specificity
    Expressed in the crypts of Lieberkuhn of the intestine and in intestinal neoplasia (at protein level).
  • Sequence similarities
    Belongs to the RRM MRD1 family.
    Contains 6 RRM (RNA recognition motif) domains.
  • Cellular localization
    Nucleus > nucleolus. Nucleus > nucleoplasm. Cytoplasm. Chromosome. In discrete foci distributed throughout the cytoplasm and nucleoplasm during the 4 to 8 cell stages and the morula stage, but not in the periphery of the nucleolar precursor body (NPB). During blastocyst development, becomes increasingly localized to the nucleolus and less to the cytoplasm. At the late blastocyst stage, localized predominantly in the nucleolus. Localized in the nucleolus during interphase and to the perichromosomal sheath during mitosis. Does not colocalize in the cytoplasm with GW182 in P-bodies. May translocate to the nucleolus upon early embryonic development (By similarity). Colocalizes with NPM1 during interphase. By late prophase, metaphase, anaphase and telophase, associates with the chromosome periphery. By telophase localizes to NPB.
  • Information by UniProt

Images

  • ab160706 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up