Overview

  • Product name
    Recombinant Human RBM22 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICAR PFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAG LSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKL ARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKD RYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRN HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF NLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPI HYPSQDPQRMGAHAGKHSSP
    • Amino acids
      1 to 420
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cwc2
    • FLJ10290
    • fSAP47
    • Functional spliceosome associated protein 47
    • Pre mRNA splicing factor RBM22
    • Pre-mRNA-splicing factor RBM22
    • RBM 22
    • rbm22
    • RBM22_HUMAN
    • RNA binding motif protein 22
    • RNA-binding motif protein 22
    • ZC3H16
    • Zinc finger CCCH domain containing protein 16
    • Zinc finger CCCH domain-containing protein 16
    see all
  • Function
    Involved in the first step of pre-mRNA splicing. Binds directly to the internal stem-loop (ISL) domain of the U6 snRNA and to the pre-mRNA intron near the 5' splice site during the activation and catalytic phases of the spliceosome cycle. Involved in both translocations of the nuclear SLU7 to the cytoplasm and the cytosolic calcium-binding protein PDCD6 to the nucleus upon cellular stress responses.
  • Sequence similarities
    Belongs to the SLT11 family.
    Contains 1 C3H1-type zinc finger.
    Contains 1 RRM (RNA recognition motif) domain.
  • Domain
    The C-terminus RRM domain and the zinc finger motif are necessary for RNA-binding.
  • Cellular localization
    Nucleus. Cytoplasm. Mainly located in the nucleus. Translocated from the nucleus to the cytoplasm after heat shock cell treatment. May be shuttling between the nucleus and the cytosol.
  • Information by UniProt

Images

  • ab163182 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up