Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP98179
    • SpeciesHuman
    • SequenceMSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFG FITFTNPEHASVAMRAMNGESLDGRQIRVD
    • Molecular weight34 kDa
    • Amino acids1 to 80

Specifications

Our Abpromise guarantee covers the use of ab116747 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 2600016C11Rik
    • IS1 RNPL
    • MGC105811
    • MGC118410
    • OTTHUMP00000025800
    • OTTHUMP00000025802
    • OTTMUSP00000019634
    • OTTMUSP00000019635
    • OTTMUSP00000019636
    • Putative RNA binding protein 3
    • Putative RNA-binding protein 3
    • Rbm3
    • RBM3_HUMAN
    • RNA binding motif (RNP1, RRM) protein 3
    • RNA binding motif protein 3
    • RNA-binding motif protein 3
    • RNA-binding protein 3
    • RNPL
    • RP23-27I6.7
    see all
  • FunctionCold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphoryaltion of translation initiation factors and active polysome formation.
  • Sequence similaritiesContains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Arg-105 is dimethylated, probably to asymmetric dimethylarginine.
    Phosphorylated.
  • Cellular localizationNucleus. Cytoplasm. Cell projection > dendrite. Localizes in mRNA granules in dentrites.
  • Information by UniProt

Recombinant Human RBM3 protein images

  • 12.5% SDS-PAGE analysis of ab116747 at approximately 34.43kDa, stained with Coomassie Blue.

References for Recombinant Human RBM3 protein (ab116747)

ab116747 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116747.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"