Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSSEEGKLFVGGLNFNTDEQALEDHFS SFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQI RVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGY GYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 157
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Purity
    >95% by SDS-PAGE .
    ab156355 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • 2600016C11Rik
    • IS1 RNPL
    • MGC105811
    • MGC118410
    • OTTHUMP00000025800
    • OTTHUMP00000025802
    • OTTMUSP00000019634
    • OTTMUSP00000019635
    • OTTMUSP00000019636
    • Putative RNA binding protein 3
    • Putative RNA-binding protein 3
    • Rbm3
    • RBM3_HUMAN
    • RNA binding motif (RNP1, RRM) protein 3
    • RNA binding motif protein 3
    • RNA-binding motif protein 3
    • RNA-binding protein 3
    • RNPL
    • RP23-27I6.7
    see all
  • Function
    Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphoryaltion of translation initiation factors and active polysome formation.
  • Sequence similarities
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Arg-105 is dimethylated, probably to asymmetric dimethylarginine.
    Phosphorylated.
  • Cellular localization
    Nucleus. Cytoplasm. Cell projection > dendrite. Localizes in mRNA granules in dentrites.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156355 (3 µg).

References

ab156355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up