Overview

  • Product name
    Recombinant Human RBM38 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASL RKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIID GRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAI VQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAA SFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
    • Amino acids
      1 to 239
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CLL associated antigen KW 5
    • CLL-associated antigen KW-5
    • HSRNASEB
    • RBM38
    • RBM38_HUMAN
    • RNA binding motif protein 38
    • RNA binding protein 38
    • RNA binding region (RNP1, RRM) containing 1
    • RNA binding region containing protein 1
    • RNA-binding motif protein 38
    • RNA-binding protein 38
    • RNA-binding region-containing protein 1
    • RNPC1
    • SEB4
    • SEB4B
    • SEB4D
    • ssDNA binding protein SEB4
    • ssDNA-binding protein SEB4
    see all
  • Function
    RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation.
  • Sequence similarities
    Belongs to the RBM38 family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Cellular localization
    Cytoplasm, cytosol. Nucleus.
  • Information by UniProt

Images

  • ab163121 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up