Overview

  • Product name
    Recombinant Human RBM42 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGAGPAPGLPGAGGPVVPGPGAGIPGKSGEERLKEMEAEMALFEQEVLG APVPGIPTAVPAVPTVPTVPTVEAMQVPAAPVIRPIIATNTYQQVQQTLE ARAAAAATVVPPMVGGPPFVGPVGFGPGDRSHLDSPEAREAMFLRRAAVA PQRAPILRPAFVPHVLQRADSALSSAAAGPRPMALRPPHQALVGPPLPGP PGPPMMLPPMARAPGPPLGSMAALRPPLEEPAAPRELGLGLGLGLKEKEE AVVAAAAGLEEASAAVAVGAGGAPAGPAVIGPSLPLALAMPLPEPEPLPL PLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALEVPEPLGEDKKK GKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARA FSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSR PIKLRKSMWKDRNLDVVRKKQKEKKKLGLR
    • Amino acids
      1 to 480
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC10433
    • RNA binding motif protein 42
    • RNA binding protein 42
  • Relevance
    RNA binding motif protein 42 (RBM42) C-terminal domain interacts with HNRNPK C-terminla domain and RNA. RBM42 and HNRNPK are involved in the maintenance of cellular ATP levels during stress, possibly by protecting critical mRNAs. Upon stress response, RBM42 localizes with HNRNPK in cytoplasmic aggregates of stalled translational pre-initiation complexes called stress granules. There are 4 isoforms produced by alternative splicing.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab163996 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up