Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YIASPVSAYQVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPL AQQMSHLSLGSTGTYMPATSAMQGAYLPQYAHMQTTAVPV
    • Amino acids
      291 to 380
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • c myc gene single strand binding protein 2
    • C2orf12
    • Cervical cancer oncogene 4
    • HCC 4
    • MSSP
    • MSSP 2
    • MSSP 3
    • MSSP-1
    • MSSP-2
    • MSSP-3
    • MSSP1
    • RBMS1
    • RBMS1_HUMAN
    • RNA binding motif, single stranded interacting protein 1
    • RNA-binding motif
    • SCR2
    • Single stranded DNA binding protein MSSP 1
    • Single-stranded DNA-binding protein MSSP-1
    • single-stranded-interacting protein 1
    • suppressor of cdc 2 (cdc13) with RNA binding motif 2
    • Suppressor of CDC2 with RNA binding motif 2
    • Suppressor of CDC2 with RNA-binding motif 2
    • YC1
    see all
  • Function
    Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication.
  • Tissue specificity
    Highest amounts are found in placenta, lung and heart.
  • Sequence similarities
    Contains 2 RRM (RNA recognition motif) domains.
  • Developmental stage
    Expressed at highest levels during the G1 to S transition of the cell cycle.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159320 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up