Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHM IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG EKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
    • Molecular weight
      41 kDa including tags
    • Amino acids
      1 to 135

Specifications

Our Abpromise guarantee covers the use of ab114570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cellular retinol binding protein
    • Cellular retinol-binding protein
    • Cellular retinol-binding protein I
    • CRABP I
    • CRBP
    • CRBP-I
    • CRBP1
    • CRBPI
    • RBP 1
    • RBP1
    • RBPC
    • RET1_HUMAN
    • Retinol binding protein 1 cellular
    • Retinol-binding protein 1
    see all
  • Function
    Intracellular transport of retinol.
  • Tissue specificity
    Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
  • Sequence similarities
    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain
    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human RBP1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human RBP1 protein (ab114570)

ab114570 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up