Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09455
    • SpeciesHuman
    • SequenceMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHM IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG EKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
    • Molecular weight41 kDa including tags
    • Amino acids1 to 135

Specifications

Our Abpromise guarantee covers the use of ab114570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cellular retinol binding protein
    • Cellular retinol-binding protein
    • Cellular retinol-binding protein I
    • CRABP I
    • CRBP
    • CRBP-I
    • CRBP1
    • CRBPI
    • RBP 1
    • RBP1
    • RBPC
    • RET1_HUMAN
    • Retinol binding protein 1 cellular
    • Retinol-binding protein 1
    see all
  • FunctionIntracellular transport of retinol.
  • Tissue specificityDetected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
  • Sequence similaritiesBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • DomainForms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human RBP1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human RBP1 protein (ab114570)

ab114570 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"