Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP09455
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMDPPAGFVRAGNPAVAAPQSPLSPEGA HFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNE NFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDF QVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDE LHLEMRVEGVVCKQVFKKVQ
    • Molecular weight25 kDa including tags
    • Amino acids1 to 197
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.32% Tris HCl, 0.03% DTT, 1.17% Sodium chloride

General Info

  • Alternative names
    • Cellular retinol binding protein
    • Cellular retinol-binding protein
    • Cellular retinol-binding protein I
    • CRABP I
    • CRBP
    • CRBP-I
    • CRBP1
    • CRBPI
    • RBP 1
    • RBP1
    • RBPC
    • RET1_HUMAN
    • Retinol binding protein 1 cellular
    • Retinol-binding protein 1
    see all
  • FunctionIntracellular transport of retinol.
  • Tissue specificityDetected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
  • Sequence similaritiesBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • DomainForms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human RBP1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab115723

References for Recombinant Human RBP1 protein (ab115723)

ab115723 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"