Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVL VCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
    • Molecular weight
      36 kDa including tags
    • Amino acids
      45 to 134

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cellular retinol binding protein II
    • Cellular retinol-binding protein II
    • CRABP II
    • Crbp 2
    • CRBP II
    • CRBP-II
    • CRBP2
    • CrbpII
    • MGC159254
    • MGC159256
    • Rbp 2
    • Rbp2
    • RBPC2
    • RET2_HUMAN
    • Retinol binding protein 2
    • Retinol binding protein 2 cellular
    • Retinol-binding protein 2
    see all
  • Function
    Intracellular transport of retinol.
  • Tissue specificity
    Higher expression in adult small intestine and to a much lesser extent in fetal kidney.
  • Sequence similarities
    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain
    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up