Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP10745
    • SpeciesHuman
    • SequenceGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSV GASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH
    • Molecular weight36 kDa including tags
    • Amino acids1149 to 1246

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D10S64
    • D10S65
    • D10S66
    • Interphotoreceptor retinoid binding protein
    • Interphotoreceptor retinoid-binding protein
    • Interstitial retinol binding protein
    • Interstitial retinol-binding protein
    • IRBP
    • RBP 3
    • rbp3
    • RBPI
    • RET3_HUMAN
    • Retinol binding protein 3
    • Retinol binding protein 3 interstitial
    • Retinol-binding protein 3
    see all
  • FunctionIRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
  • Sequence similaritiesBelongs to the peptidase S41A family.
  • Cellular localizationSecreted > extracellular space > extracellular matrix > interphotoreceptor matrix. Interphotoreceptor matrix that permeates the space between the retina and the contiguous layer of pigment epithelium cells.
  • Information by UniProt

Recombinant Human RBP3 protein images

  • 12.5% SDS-PAGE showing ab116892 at approximately36.41kDa stained with Coomassie Blue

References for Recombinant Human RBP3 protein (ab116892)

ab116892 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"