Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP02753
    • SpeciesHuman
    • SequenceMERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDE TGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQK GNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQ KIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
    • Molecular weight21 kDa
    • Amino acids19 to 201

Specifications

Our Abpromise guarantee covers the use of ab111460 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityImmune reactive in ELISA using monoclonal anti-CD4 in gpl2O capture ELISA assays.
  • Applications

    SDS-PAGE

    HPLC

  • Purity> 95 % SDS-PAGE.
    Purity is greater than 95% by HPLC and SDS-PAGE.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.40
    Constituent: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • OTTHUMP00000020114
    • OTTHUMP00000020115
    • OTTHUMP00000020116
    • Plasma retinol binding protein 4
    • Plasma retinol-binding protein
    • Plasma retinol-binding protein(1-176)
    • PRBP
    • PRO2222
    • RBP
    • RBP4
    • RDCCAS
    • RET4_HUMAN
    • Retinol binding protein 4
    • Retinol binding protein 4 interstitial
    • Retinol binding protein 4 plasma
    see all
  • FunctionDelivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli.
  • Involvement in diseaseDefects in RBP4 are a cause of retinol-binding protein deficiency (RBP deficiency) [MIM:180250]. This condition causes night vision problems. It produces a typical 'fundus xerophthalmicus', featuring a progressed atrophy of the retinal pigment epithelium.
  • Sequence similaritiesBelongs to the calycin superfamily. Lipocalin family.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant human RBP4 protein (ab111460)

ab111460 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111460.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"