Overview

  • Product name
    Recombinant Human RBP5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPPNLTGYYRFVSQKNMEDYLQALNISLAV RKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDG RKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQV FRKVR
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 135
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99438 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • Cellular retinol-binding protein III
    • CRBP III
    • CRBP-III
    • CRBP3
    • CRBPIII
    • HRBPiso
    • OTTHUMP00000238163
    • Putative cellular retinol binding protein CRBP III
    • RBP5
    • RET5_HUMAN
    • Retinol binding protein
    • Retinol binding protein 5
    • Retinol binding protein 5, cellular
    • Retinol-binding protein 5
    see all
  • Function
    Intracellular transport of retinol.
  • Tissue specificity
    Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level).
  • Sequence similarities
    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain
    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human RBP5 protein images

  • 15% SDS-PAGE showing ab99438 at approximately 18.1kDa (3µg).

References for Recombinant Human RBP5 protein (ab99438)

ab99438 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up