Overview

  • Product name
    Recombinant Human RBP5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPPNLTGYYRFVSQKNMEDYLQALNISLAV RKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDG RKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQV FRKVR
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 135
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99438 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • Cellular retinol-binding protein III
    • CRBP III
    • CRBP-III
    • CRBP3
    • CRBPIII
    • HRBPiso
    • OTTHUMP00000238163
    • Putative cellular retinol binding protein CRBP III
    • RBP5
    • RET5_HUMAN
    • Retinol binding protein
    • Retinol binding protein 5
    • Retinol binding protein 5, cellular
    • Retinol-binding protein 5
    see all
  • Function
    Intracellular transport of retinol.
  • Tissue specificity
    Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level).
  • Sequence similarities
    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain
    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99438 at approximately 18.1kDa (3µg).

References

ab99438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up