Recombinant Human RBPSUHL protein (ab161411)

Overview

  • Product name
    Recombinant Human RBPSUHL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHT TILRGGVRRCLQQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLSGPG WRVKPGQDQAHQAGETGPTVCGYMGLDSASGSATETQKLNFEQQPDSREF GCAKTLYISDADKRKHFRLVLRLVLRGGRELGTFHSRLIKVISKPSQKKQ SLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVASARQWAAFTL HLADGHSAQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCAL LDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANR ALLNDSSCWTIIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVA TLELHGENFHAGLKVWFGDVEAETMYRSPRSLVCVVPDVAAFCSDWRWLR APITIPMSLVRADGLFYPSAFSFTYTPEYSVRPGHPGVPEPATDADALLE SIHQEFTRTNFHLFIQT
    • Amino acids
      1 to 517
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hCG_38385
    • RBP L
    • RBP-L
    • RBPL
    • RBPSUHL
    • Recombination signal binding protein for immunoglobulin kappa J region like
    • Recombining binding protein L
    • Recombining binding protein suppressor of hairless (Drosophila)-like
    • Recombining binding protein suppressor of hairless (Drosophila)-like, isoform CRA_b
    • Recombining binding protein suppressor of hairless like protein
    • RP3 453C12.2 002
    • SUH
    • SUHL
    • Transcription factor RBP L
    • Transcription factor RBP-L
    • Transcription factor RBPL
    see all
  • Relevance
    RBPSUHL is a protein similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein. In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2).
  • Cellular localization
    Nuclear

Images

  • ab161411 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up