Overview

  • Product name
    Recombinant Human RC3H2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YVNAVDSRWSSYGNEATSSAHYVERDRFIVTDLSGHRKHSSTGDLLSLEL QQAKSNSLLLQREANALAMQQKWNSLDEGRHLTLNLLSKEIELRNGEVKK
    • Amino acids
      748 to 847
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2900024N03Rik
    • 9430019J22Rik
    • D930043C02Rik
    • FLJ20301
    • FLJ20713
    • Membrane associated DNA binding protein
    • Membrane associated nucleic acid binding protein
    • Membrane-associated nucleic acid-binding protein
    • MGC52176
    • MNAB
    • OTTHUMP00000022076
    • OTTHUMP00000022077
    • OTTMUSP00000013545
    • OTTMUSP00000013546
    • Rc3h2
    • RC3H2_HUMAN
    • Ring finger and CCCH type domains 2
    • RING finger and CCCH type zinc finger domain containing protein 2
    • Ring finger and CCCH-type zinc finger domain-containing protein 2
    • ring finger and CCCH-type zinc finger domains 2
    • RING finger protein 164
    • RNF164
    • roquin-2
    • RP23-321B3.1
    see all
  • Tissue specificity
    Expressed in spleen, testis, ovary and small intestine.
  • Sequence similarities
    Contains 1 C3H1-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Cellular localization
    Cytoplasm > perinuclear region. Endomembrane system. Membrane-associated. Primarily localizes to the perinuclear space, probably to the endoplasmic reticulum or trans-Golgi network.
  • Information by UniProt

Images

  • ab162775 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162775 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up