Overview

  • Product name
    Recombinant Human RCE1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRAC
    • Amino acids
      133 to 182
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAAX prenyl protease 2
    • FACE 2
    • FACE2
    • Farnesylated protein converting enzyme 2
    • Farnesylated proteins converting enzyme 2
    • hRCE 1
    • hRCE1
    • Prenyl protein peptidase RCE1
    • Prenyl protein specific endoprotease 2
    • RCE 1
    • RCE 1A
    • RCE 1B
    • RCE1 homolog prenyl protein peptidase
    • RCE1A
    • RCE1B
    see all
  • Relevance
    RCE1 (RCE1 homolog, prenyl protein peptidase) is a member of the metalloproteinase family. It functions in the maintenance and processing of CAAX-type prenylated proteins, proteolytically removing the C-terminal three residues of farnesylated and geranylated proteins.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein.

Images

  • ab160745 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up