Overview

  • Product nameRecombinant Human RCL protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO43598
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAAMVPGRSESWERGEPGRPALYFCGSIR GGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQD LEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAM IRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT
    • Molecular weight21 kDa including tags
    • Amino acids1 to 174
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab100943 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2' deoxynucleoside 5' phosphate N hydrolase 1
    • BC048355
    • c Myc responsive
    • c Myc responsive protein Rcl
    • c-Myc-responsive protein Rcl
    • C6orf108
    • C76683
    • Chromosome 6 open reading frame 108
    • Deoxyribonucleoside 5' monophosphate N glycosidase
    • Deoxyribonucleoside 5''-monophosphate N-glycosidase
    • dJ330M21.3
    • DNPH1
    • MGC54855
    • Putative c Myc responsive
    • Rcl
    • RCL_HUMAN
    • RP3 330M21.3
    see all
  • FunctionCatalyzes the cleavage of the N-glycosidic bond of deoxyribonucleoside 5'-monophosphates to yield deoxyribose 5-phosphate and a purine or pyrimidine base. Deoxyribonucleoside 5'-monophosphates containing purine bases are preferred to those containing pyrimidine bases.
  • Tissue specificityExpressed at low levels in brain, colon, lung, peripheral blood leukocytes, placenta, small intestine, and thymus. Expressed at high levels in heart, kidney, liver, skeletal muscle and spleen. Overexpressed in a significant proportion of breast cancers.
  • Sequence similaritiesBelongs to the deoxyribonucleoside 5'-monophosphate N-glycosidase family.
  • Cellular localizationNucleus. Cytoplasm.
  • Information by UniProt

Recombinant Human RCL protein images

  • 15% SDS-PAGE showing ab100943 at approximately 21.2kDa (3µg).

References for Recombinant Human RCL protein (ab100943)

ab100943 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab100943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"