Overview

  • Product nameRecombinant Human RCN1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15293
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEKPTVRKERVVR PDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDR IDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEY KQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREE FTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGP EPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVY ESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
    • Molecular weight40 kDa including tags
    • Amino acids30 to 331
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity>= 80 % SDS-PAGE.
    Purity > 80% by SDS-PAGE. ab98241 was purified using conventional chromatography techniques
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Epididymis secretory protein Li 84
    • FLJ37041
    • HEL S 84
    • PIG20
    • Proliferation inducing gene 20
    • RCAL
    • RCN
    • RCN 1
    • rcn1
    • RCN1_HUMAN
    • Reticulocalbin 1
    • Reticulocalbin 1 EF hand calcium binding domain
    • Reticulocalbin-1
    • Reticulocalbin1
    see all
  • FunctionMay regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
  • Sequence similaritiesBelongs to the CREC family.
    Contains 6 EF-hand domains.
  • Cellular localizationEndoplasmic reticulum lumen.
  • Information by UniProt

Recombinant Human RCN1 protein images

  • 15% SDS-PAGE analysis of 3µg ab98241

References for Recombinant Human RCN1 protein (ab98241)

ab98241 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"