Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ14257
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEELHYPLGERRSDYDREALLGV QEDVD EYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHY AMQ EAKQQFVEYDKNSDDTVTWDEYNIQMYDRVIDFDENTALDDAEEESF R KLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEE HDKNGDGFVSLEEFLGDYRWDPTANEDPEWILVEKDRFVNDYDKDNDGR L DPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILENPDL FLTSEATDYGRQLHDDYFYHDEL
    • Molecular weight37 kDa including tags
    • Amino acids26 to 317
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab105594 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Calcium binding protein ERC 55
    • Calcium-binding protein ERC-55
    • E6 binding protein
    • E6-binding protein
    • E6BP
    • ERC 55
    • ERC55
    • Rcn2
    • RCN2_HUMAN
    • Reticulocalbin 2 EF hand calcium binding domain (endoplasmic reticulum calcium binding protein 55kD)
    • Reticulocalbin 2, EF hand calcium binding domain
    • Reticulocalbin-2
    • TCBP49
    see all
  • FunctionNot known. Binds calcium.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the CREC family.
    Contains 6 EF-hand domains.
  • Cellular localizationEndoplasmic reticulum lumen.
  • Information by UniProt

Recombinant Human RCN2 protein images

  • 15% SDS-PAGEanalysis of 3µg ab105594.

References for Recombinant Human RCN2 protein (ab105594)

ab105594 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"