Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEELHYPLGERRSDYDREALLGV QEDVD EYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHY AMQ EAKQQFVEYDKNSDDTVTWDEYNIQMYDRVIDFDENTALDDAEEESF R KLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEE HDKNGDGFVSLEEFLGDYRWDPTANEDPEWILVEKDRFVNDYDKDNDGR L DPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILENPDL FLTSEATDYGRQLHDDYFYHDEL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      26 to 317
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab105594 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Calcium binding protein ERC 55
    • Calcium-binding protein ERC-55
    • E6 binding protein
    • E6-binding protein
    • E6BP
    • ERC 55
    • ERC55
    • Rcn2
    • RCN2_HUMAN
    • Reticulocalbin 2 EF hand calcium binding domain (endoplasmic reticulum calcium binding protein 55kD)
    • Reticulocalbin 2, EF hand calcium binding domain
    • Reticulocalbin-2
    • TCBP49
    see all
  • Function
    Not known. Binds calcium.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the CREC family.
    Contains 6 EF-hand domains.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • 15% SDS-PAGEanalysis of 3µg ab105594.

References

ab105594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up