Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAI FFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQ MVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNA SQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAK QVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIK LRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
    • Amino acids
      1 to 299
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B cell receptor associated protein BAP37
    • B-cell receptor-associated protein BAP37
    • BAP
    • Bap37
    • BCAP 37
    • D prohibitin
    • D-prohibitin
    • p22
    • Phb2
    • PHB2_HUMAN
    • PNAS 141
    • Prohibitin 2
    • Prohibitin-2
    • Repressor of estrogen receptor activity
    see all
  • Function
    Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging.
  • Sequence similarities
    Belongs to the prohibitin family.
  • Developmental stage
    Levels of expression in fibroblasts decrease heterogeneously during cellular aging.
  • Cellular localization
    Mitochondrion inner membrane. Cytoplasm. Nucleus. Also cytoplasmic and nuclear.
  • Information by UniProt

Images

  • ab153180 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up