Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KFGCSQYECVPRQLACDQVQDPVCDTDHMEHNNLCTLYQRGKSLSYKGPC QPFCRATEPVCGHNGETYSSVCAAYSDRVAVDYYGDCQAVGVLSEHSSVA
    • Amino acids
      701 to 800
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hRECK
    • Membrane anchored glycoprotein (metastasis and invasion)
    • RECK
    • RECK protein
    • RECK_HUMAN
    • Reversion inducing cysteine rich protein with Kazal motifs
    • Reversion-inducing cysteine-rich protein with Kazal motifs
    • ST15
    • Suppression of tumorigenicity 15 (reversion inducing cysteine rich protein with kazal motifs)
    • Suppressor of tumorigenicity 15
    • Suppressor of tumorigenicity 15 protein
    see all
  • Function
    Negatively regulates matrix metalloproteinase-9 (MMP-9) by suppressing MMP-9 secretion and by direct inhibition of its enzymatic activity. RECK down-regulation by oncogenic signals may facilitate tumor invasion and metastasis. Appears to also regulate MMP-2 and MT1-MMP, which are involved in cancer progression.
  • Tissue specificity
    Expressed in various tissues and untransformed cells. It is undetectable in tumor-derived cell lines and oncogenically transformed cells.
  • Sequence similarities
    Contains 3 Kazal-like domains.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab160024 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up