Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKET ADAITKEAKKATVNLLGEEKKS
    • Amino acids
      113 to 184
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C5orf18
    • D5S346
    • Deleted in polyposis 1
    • DP1
    • Polyposis coli region hypothetical protein DP1
    • Polyposis locus protein 1
    • Protein TB2
    • Receptor accessory protein 5
    • Receptor expression enhancing protein 5
    • TB2
    • TB2 protein
    • YOP1
    see all
  • Relevance
    May promote functional cell surface expression of olfactory receptors.
  • Cellular localization
    Cell Membrane

Images

  • ab159908 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up