Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSP CYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYS YIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLS RSTGFLKWKDYNCDAKLPYVCKFKD
    • Amino acids
      1 to 175
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LPPM429
    • Pancreatitis-associated protein 1B
    • Pancreatitis-associated protein IB
    • PAP IB
    • PAP-1B
    • PAP1B
    • PAPIB
    • REG III
    • Reg III-gamma
    • REG-3-gamma
    • REG3G
    • REG3G_HUMAN
    • Regenerating islet derived 3 gamma
    • Regenerating islet-derived protein 3-gamma
    • Regenerating islet-derived protein III-gamma
    • UNQ429
    see all
  • Function
    Might be a stress protein involved in the control of bacterial proliferation.
  • Tissue specificity
    Expressed almost exclusively in the pancreas. Also expressed in testis. Not found in small intestine.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab165324 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up