Recombinant human REG4 protein (ab182679)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human REG4 protein
See all REG4 proteins and peptides -
Biological activity
Measured by the ability of the immobilized protein to support the proliferation of HCT-116 Human colorectal carcinoma cells (ATCC: CCL-247) under low serum conditions.
The ED50 for this effect is typically 3-15 μg/ml.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILS LKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKS MGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP -
Predicted molecular weight
17 kDa including tags -
Amino acids
23 to 158 -
Tags
His tag C-Terminus -
Additional sequence information
AAH17089. Mature form.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab182679 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
DTT-reduced REG4 protein migrates as 18 kDa due to glycosylation.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- Gastrointestinal secretory protein
- GISP
- Reg IV
see all -
Function
May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium. -
Tissue specificity
Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in normal colon. Preferentially expressed in mucinous tumors and in some cases neuro-endocrine tumors. Expressed in mucus-secreting cells and enterocyte-like cells. In small intestine expressed at the basal perinuclear zone of goblet cells. -
Sequence similarities
Contains 1 C-type lectin domain. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab182679 has not yet been referenced specifically in any publications.