Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILS LKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKS MGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
    • Molecular weight
      17 kDa including tags
    • Amino acids
      23 to 158
    • Tags
      His tag C-Terminus
    • Additional sequence information
      AAH17089. Mature form.

Specifications

Our Abpromise guarantee covers the use of ab182679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by the ability of the immobilized protein to support the proliferation of HCT-116 Human colorectal carcinoma cells (ATCC: CCL-247) under low serum conditions.

    The ED50 for this effect is typically 3-15 μg/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes

    DTT-reduced REG4 protein migrates as 18 kDa due to glycosylation.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Gastrointestinal secretory protein
    • GISP
    • Reg IV
    • REG like protein
    • REG-4
    • REG-like protein
    • Reg4
    • REG4_HUMAN
    • Regenerating gene type IV
    • Regenerating islet derived family member 4
    • Regenerating islet derived protein 4 precursor
    • Regenerating islet-derived protein 4
    • Regenerating islet-derived protein IV
    • REGIV
    • RELP
    see all
  • Function
    May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium.
  • Tissue specificity
    Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in normal colon. Preferentially expressed in mucinous tumors and in some cases neuro-endocrine tumors. Expressed in mucus-secreting cells and enterocyte-like cells. In small intestine expressed at the basal perinuclear zone of goblet cells.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • The purity of ab182679 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue.

References

ab182679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up