Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSA SLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLF AGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEKLDKSWSQESC LQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLA RCREVSVEVGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDS AAKEPPAPRRPASLAQRARRFLARLTARSARRRALKARSKSCHNLAVL
    • Amino acids
      1 to 298
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E030011C07Rik
    • GD:REM
    • GES
    • GTP binding protein REM
    • GTP binding protein REM 1
    • GTP binding protein REM1
    • GTP-binding protein REM 1
    • GTPase GES
    • GTPase regulating endothelial cell sprouting
    • GTPase-regulating endothelial cell sprouting
    • MGC114556
    • MGC48669
    • OTTMUSP00000016855
    • Rad and Gem like GTP binding protein 1
    • Rad and Gem-like GTP-binding protein 1
    • RAS (RAD and GEM) like GTP binding
    • RAS like GTP binding
    • RAS like GTP binding protein REM
    • REM 1
    • Rem1
    • REM1_HUMAN
    • RP23-35I8.9
    see all
  • Function
    Promotes endothelial cell sprouting and actin cytoskeletal reorganization. May be involved in angiogenesis. May function in Ca(2+) signaling.
  • Tissue specificity
    Most highly expressed in the endothelial lining of the blood vessels in uterus and heart. Lower levels found in spleen, lymph node, kidney and testis. Also found in cells with secretory function such as the islets of Langerhans, lobule/duct epithelium in the breast, bile duct epithelium in the liver, surface epithelium in the endometrial glands of the uterus, colon mucosa and acinar cells in the pancreas and the prostate.
  • Sequence similarities
    Belongs to the small GTPase superfamily. RGK family.
  • Information by UniProt

Images

  • ab162179 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162179 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up