Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQF RDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      311 to 410

Specifications

Our Abpromise guarantee covers the use of ab114778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGE
    • GlcNAc 2 epimerase
    • GlcNAc 2-epimerase
    • N acetyl D glucosamine 2 epimerase
    • N-acetyl-D-glucosamine 2-epimerase
    • N-acylglucosamine 2-epimerase
    • RBP
    • RENBP
    • RENBP_HUMAN
    • Renin binding protein
    • Renin-binding protein
    • RnBP
    see all
  • Function
    Catalyzes the interconversion of N-acetylglucosamine to N-acetylmannosamine. Binds to renin forming a protein complex called high molecular weight (HMW) renin and inhibits renin activity.
  • Sequence similarities
    Belongs to the N-acylglucosamine 2-epimerase family.
  • Information by UniProt

Images

  • ab114778 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up