Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP51606
    • SpeciesHuman
    • SequenceFCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQF RDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR
    • Molecular weight37 kDa including tags
    • Amino acids311 to 410

Specifications

Our Abpromise guarantee covers the use of ab114778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGE
    • GlcNAc 2 epimerase
    • GlcNAc 2-epimerase
    • N acetyl D glucosamine 2 epimerase
    • N-acetyl-D-glucosamine 2-epimerase
    • N-acylglucosamine 2-epimerase
    • RBP
    • RENBP
    • RENBP_HUMAN
    • Renin binding protein
    • Renin-binding protein
    • RnBP
    see all
  • FunctionCatalyzes the interconversion of N-acetylglucosamine to N-acetylmannosamine. Binds to renin forming a protein complex called high molecular weight (HMW) renin and inhibits renin activity.
  • Sequence similaritiesBelongs to the N-acylglucosamine 2-epimerase family.
  • Information by UniProt

Recombinant Human RENBP protein images

  • ab114778 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human RENBP protein (ab114778)

ab114778 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"