Recombinant human Renin protein (ab135012)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 80% SDS-PAGE
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human Renin protein
See all Renin proteins and peptides -
Biological activity
Activity: 255 pmol/min/µg.
Assay conditions: activity was measured with Renin titrated from 8 ng/rxn -0.125 ng/rxn.
-
Purity
> 80 % SDS-PAGE.
Affinity purified. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSK CSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVG GITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQ GVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGV WQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKK RLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAI HAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR -
Predicted molecular weight
39 kDa including tags -
Amino acids
67 to 406 -
Tags
His tag C-Terminus -
Additional sequence information
Pro-form aa22-406: 44KDa including tag. Mature form aa67-406: 39 Kda including tag
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab135012 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Liquid -
Additional notes
255 pmol/min/µg -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Preservative: 1.36% Imidazole
Constituents: 0.02% Potassium chloride, 0.63% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.64% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Angiotensin forming enzyme
- Angiotensin forming enzyme precursor
- Angiotensinogenase
see all -
Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. -
Involvement in disease
Defects in REN are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
Defects in REN are the cause of familial juvenile hyperuricemic nephropathy type 2 (HNFJ2) [MIM:613092]. It is a renal disease characterized by juvenile onset of hyperuricemia, slowly progressive renal failure and anemia. -
Sequence similarities
Belongs to the peptidase A1 family. -
Cellular localization
Secreted. Membrane. Associated to membranes via binding to ATP6AP2. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab135012 has not yet been referenced specifically in any publications.