Overview

  • Product name
    Recombinant Human REPS1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELCGATRLGYFGRSQFYIALKLVAVAQSGFPLRVESINTVKDLPLPRFV ASKNEQESRHAASYSSDSENQGSYSGVIPPPPGRGQVKKGSVSHDTVQPR TSADAQEPASPVVSPQQSPPTSPHTWRKHSRHPSGGNSERPLAGPGPFWS PFGEAQSGSSAGDAVWSGHSPPPPQENWVSFADTPPTSTLLTMHPASVQD QTTVRTVASATTAIEIRRQSSSYDDPWKITDEQRQYYVNQFKTIQPDLNG FIPGSAAKEFFTKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVA RKNGYDLPEKLPESLMPKLIDLEDSADVGDQPGEVGYSGSPAEAPPSKSP SMPSLNQTWPELNQSSEDTAIVHPVPIRMTPSKIHMQEMELKRTGSDHTN PTSPLLVKPSDLLEENKINSSVKFASGNTVGQQQAGVVAHPPAVPPRPQP SQAPGPAVHRPVDADGLITHTSTSPQQIPEQPNFADFSQFEVFAASNVND EQDDEAEKHPEVLPAEKASDPASSLRVAKTDSKTEEKTAASAPANVSKGT TPLAPPPKPVRRRLKSEDELRPEVDEHTQKTGVLAAVLASQPSIPRSVGK DKKAIQASIRRNKETNTVLARLNSELQQQLKDVLEERISLEVQLEQLRPF SHL
    • Amino acids
      1 to 653
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • RALBP1
    • RalBP1 associated Eps domain containing protein 1
    • RalBP1 interacting protein 1
    • RalBP1-associated Eps domain-containing protein 1
    • RalBP1-interacting protein 1
    • REPS1
    • REPS1_HUMAN
    see all
  • Function
    May coordinate the cellular actions of activated EGF receptors and Ral-GTPases.
  • Sequence similarities
    Contains 1 EF-hand domain.
    Contains 2 EH domains.
  • Post-translational
    modifications
    EGF stimulates phosphorylation on Tyr-residues.
  • Cellular localization
    Membrane > clathrin-coated pit. Colocalize with ITSN1 at the plasma membrane in structures that are most probably clathrin-coated pits.
  • Information by UniProt

Images

  • ab164736 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up