Overview

  • Product name
    Recombinant Human REPS2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RVPLSHGYSKLRSSAEQMHPAPYEARQPLVQPEGSSSGGPGTKPLRHQAS LIRSFSVERELQDNSSYPDEPWRITEEQREYYVNQFRSLQPDPSSFISGS
    • Amino acids
      66 to 165
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • OTTHUMP00000022995
    • Partner of Ral binding protein 1
    • Partner of RalBP1
    • POB1
    • RALBP1 associated Eps domain containing 2
    • RALBP1 interacting protein 2
    • RALBP1-associated Eps domain-containing protein 2
    • REPS 2
    see all
  • Relevance
    REPS2 is part of a protein complex that regulates the endocytosis of growth factor receptors. It directly interacts with a GTPase activating protein that functions downstream of the small G protein Ral. Its expression can negatively affect receptor internalization and inhibit growth factor signaling. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization
    Cytoplasmic

Images

  • ab160372 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160372 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up