Overview

  • Product name
    Recombinant Human RERE protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFICSIQDFKLVH NSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNV KWYYRQSEV
    • Molecular weight
      38 kDa including tags
    • Amino acids
      85 to 193

Specifications

Our Abpromise guarantee covers the use of ab116842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110033A15Rik
    • AI414665
    • ARG
    • arginine glutamic acid dipeptide (RE) repeats
    • arginine glutamic acid dipeptide repeats
    • Arginine glutamic acid dipeptide repeats protein
    • Arginine-glutamic acid dipeptide repeats protein
    • ARGININE-GLUTAMIC ACID REPEATS-ENCODING GENE
    • ARP
    • ATN1L
    • Atr2
    • atrophin 1 like
    • Atrophin 1 like protein
    • Atrophin 1 related protein
    • atrophin 2
    • atrophin related protein
    • ATROPHIN-1-ASSOCIATED PROTEIN
    • Atrophin-1-like protein
    • Atrophin-1-related protein
    • atrophin-2
    • ATROPHIN-RELATED PROTEIN
    • AW742570
    • DNB1
    • FLJ38775
    • KIAA0458
    • mKIAA0458
    • NEDBEH
    • OTTHUMP00000001701
    • Rere
    • RERE_HUMAN
    see all
  • Function
    Plays a role as a transcriptional repressor during development. May play a role in the control of cell survival. Overexpression of RERE recruits BAX to the nucleus particularly to POD and triggers caspase-3 activation, leading to cell death.
  • Tissue specificity
    Widely expressed. Expressed in tumor cell lines.
  • Involvement in disease
    Note=A chromosomal aberration involving RERE is found in the neuroblastoma cell line. Translocation t(1;15)(p36.2;q24).
  • Sequence similarities
    Contains 1 BAH domain.
    Contains 1 ELM2 domain.
    Contains 1 GATA-type zinc finger.
    Contains 1 SANT domain.
  • Domain
    The interaction with ATN1 is mediated by the coiled coil domain.
  • Cellular localization
    Nucleus. Localized in nuclear bodies of variables size. Colocalized with PML and BAX in nuclear PODs.
  • Information by UniProt

Recombinant Human RERE protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116842 at approximately 37.62 kDa.

References for Recombinant Human RERE protein (ab116842)

ab116842 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up