Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAKSAEVKLAIFGRAGVGKSALVVRFLTKR FIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQREGHMRWGEGF VLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVST EEGEKLATELACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRR SSTTHVKQAINKMLTKISS
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 199
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab124982 is purified by proprietary chromatographic techniques and is sterile filtered. Purity is greater than 85.0% as determined by SDS-PAGE.
  • Form
    Liquid
  • Additional notes
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under desiccating conditions.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • MGC15754
    • RAS like estrogen regulated growth inhibitor
    • Ras related and estrogen regulated growth inhibitor
    • Ras-related and estrogen-regulated growth inhibitor
    • Rerg
    • RERG_HUMAN
    • Weakly similar to N ras protein [H.sapiens]
    see all
  • Function
    Binds GDP/GTP and possesses intrinsic GTPase activity. Has higher affinity for GDP than for GTP. In cell lines overexpression leads to a reduction in the rate of proliferation, colony formation and in tumorigenic potential.
  • Tissue specificity
    Detected in heart, brain, placenta, lung, liver, skin, kidney and pancreas. Detected in estrogen receptor-positive breast-derived cell lines, but not in estrogen receptor-negative cell lines. Expression is decreased or lost in a significant proportion of primary breast tumors with poor clinical prognosis.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Ras family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References for Recombinant Human RERG protein (ab124982)

ab124982 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up