Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAKSAEVKLAIFGRAGVGKSALVVRFLTKR FIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQREGHMRWGEGF VLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVST EEGEKLATELACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRR SSTTHVKQAINKMLTKISS
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 199
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab124982 is purified by proprietary chromatographic techniques and is sterile filtered. Purity is greater than 85.0% as determined by SDS-PAGE.
  • Form
    Liquid
  • Additional notes
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under desiccating conditions.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • MGC15754
    • RAS like estrogen regulated growth inhibitor
    • Ras related and estrogen regulated growth inhibitor
    • Ras-related and estrogen-regulated growth inhibitor
    • Rerg
    • RERG_HUMAN
    • Weakly similar to N ras protein [H.sapiens]
    see all
  • Function
    Binds GDP/GTP and possesses intrinsic GTPase activity. Has higher affinity for GDP than for GTP. In cell lines overexpression leads to a reduction in the rate of proliferation, colony formation and in tumorigenic potential.
  • Tissue specificity
    Detected in heart, brain, placenta, lung, liver, skin, kidney and pancreas. Detected in estrogen receptor-positive breast-derived cell lines, but not in estrogen receptor-negative cell lines. Expression is decreased or lost in a significant proportion of primary breast tumors with poor clinical prognosis.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Ras family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab124982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up