Recombinant Human Resistin protein (ab186979)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFA VTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPLEHHHHHH
    • Molecular weight
      11 kDa including tags
    • Amino acids
      19 to 108
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab186979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -80°C.

    pH: 3.00
    Constituent: 0.12% Acetic acid

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Aliquot the reconstituted solution and store at < -20°C.

General Info

  • Alternative names
    • Adipose tissue specific secretory factor
    • Adipose tissue-specific secretory factor
    • ADSF
    • C/EBP epsilon regulated myeloid specific secreted cysteine rich protein
    • C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 1
    • C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein
    • CG5403
    • Cysteine rich secreted protein A12 alpha like 2
    • Cysteine rich secreted protein FIZZ3
    • Cysteine-rich secreted protein A12-alpha-like 2
    • Cysteine-rich secreted protein FIZZ3
    • dri
    • FIZZ 3
    • FIZZ3
    • Found in inflammatory zone 3
    • HXCP 1
    • HXCP1
    • MGC126603
    • MGC126609
    • PRO1199
    • Resistin
    • Resistin delta2
    • RETN
    • RETN 1
    • RETN_HUMAN
    • RETN1
    • RSTN
    • UNQ407
    • XCP 1
    • XCP1
    see all
  • Function
    Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
  • Tissue specificity
    Expressed only in fatty tissues.
  • Sequence similarities
    Belongs to the resistin/FIZZ family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab186979 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up