Recombinant Human Reticulon 1 protein (ab114927)

Overview

  • Product nameRecombinant Human Reticulon 1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16799-3
    • SpeciesHuman
    • SequenceMQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSFLLLLFSLTQF SVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITLS QEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGAL FNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI PGAKRHAE
    • Molecular weight49 kDa including tags
    • Amino acids1 to 208

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Neuroendocrine specific protein
    • Neuroendocrine-specific protein
    • NSP
    • Reticulon 1
    • Reticulon-1
    • RTN 1
    • RTN1
    • RTN1_HUMAN
    see all
  • FunctionMay be involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
  • Tissue specificityExpressed in neural and neuroendocrine tissues and cell cultures derived therefrom. Expression of isoform RTN1-C is strongly correlated with neuronal differentiation.
  • Sequence similaritiesContains 1 reticulon domain.
  • Post-translational
    modifications
    Isoforms RTN1-A and RTN1-B are phosphorylated.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human Reticulon 1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab114927.

References for Recombinant Human Reticulon 1 protein (ab114927)

ab114927 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"