Recombinant Human Reticulon 1 protein (ab114927)

Overview

  • Product name
    Recombinant Human Reticulon 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSFLLLLFSLTQF SVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITLS QEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGAL FNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI PGAKRHAE
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 208

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Neuroendocrine specific protein
    • Neuroendocrine-specific protein
    • NSP
    • Reticulon 1
    • Reticulon-1
    • RTN 1
    • RTN1
    • RTN1_HUMAN
    see all
  • Function
    May be involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
  • Tissue specificity
    Expressed in neural and neuroendocrine tissues and cell cultures derived therefrom. Expression of isoform RTN1-C is strongly correlated with neuronal differentiation.
  • Sequence similarities
    Contains 1 reticulon domain.
  • Post-translational
    modifications
    Isoforms RTN1-A and RTN1-B are phosphorylated.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab114927.

References

ab114927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up