Recombinant Human Retinal protein 4 (ab160338)

Overview

  • Product name
    Recombinant Human Retinal protein 4
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPR PGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGT VLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFT VGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLS EELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
    • Amino acids
      1 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cone-rod dystrophy, included
    • hRG4
    • Human retinal gene 4
    • MRG4
    • POC7
    • POC7 centriolar protein homolog A
    • POC7A
    • Protein unc 119 homolog A
    • Protein unc-119 homolog A
    • Retinal protein 4
    • RG4
    • RRG4
    • Rtg4
    • U119A_HUMAN
    • unc 119 homolog (C. elegans)
    • Unc 119 protein homolog
    • UNC119
    • unc119 (C.elegans) homolog
    • Unc119h
    • Uncl19
    see all
  • Function
    Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated GNAT1 and is required for G-protein localization and trafficking in sensory neurons. Binds myristoylated NPHP3; however, in contrast to UNC119B, does not seem to play a major role in ciliary membrane localization of NPHP3. Does not bind all myristoylated proteins. Probably plays a role in trafficking proteins in photoreceptor cells.
  • Tissue specificity
    Retinal-specific. Localized in photoreceptor synapses in the outer plexiform layer of the retina.
  • Involvement in disease
    Note=Defects in UNC119 may be a cause of cone-rod dystrophy. A mutation was found in a 57-year-old woman with late-onset cone-rod dystrophy: from 40 year old, the patient suffered from poor night vision, defective color vision and light-sensitivity. At 57 year old, she displayed reduced visual acuity, myopa, macular atrophy and pericentral ring scotomas. The disease was caused by a heterozygous mutation causing premature termination and truncated UNC119 protein with dominant-negative effect.
  • Sequence similarities
    Belongs to the PDE6D/unc-119 family.
  • Domain
    Adopts an immunoglobulin-like beta-sandwich fold forming a hydrophobic cavity that capture N-terminally myristoylated target peptides (PubMed:21642972). Phe residues within the hydrophobic beta sandwich are required for myristate binding (PubMed:22085962).
  • Cellular localization
    Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Images

  • ab160338 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up